Total number of results for Sparus aurata are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02538 |
EHWSHGWYPG
|
10 | Sparus aurata | GnRH | GnRH | 7991588#Powell JF, Zohar Y, Elizur A, Park M, Fischer WH, Craig AG, Rivier JE, Lovejoy DA, Sherwood NM#Three forms of gonadotropin-releasing hormone characterized from brains of one species#Proc Natl Acad Sci U S A 1994 Dec 6;91(25):12081-5 | |
| NP02539 |
EHWSYGLSPG
|
10 | Sparus aurata | GnRH | GnRH | 7991588#Powell JF, Zohar Y, Elizur A, Park M, Fischer WH, Craig AG, Rivier JE, Lovejoy DA, Sherwood NM#Three forms of gonadotropin-releasing hormone characterized from brains of one species#Proc Natl Acad Sci U S A 1994 Dec 6;91(25):12081-5 | |
| NP04064 |
SYSMEHFRWGKPV
|
13 | Sparus aurata | Opioid | Alpha-melanocyte-stimulating hormone | 10927632#Arends RJ, Rotllant J, Metz JR, Mancera JM, Wendelaar Bonga SE, Flik G#alpha-MSH acetylation in the pituitary gland of the sea bream (Sparus aurata L#) in response to different backgrounds, confinement and air exposure J Endocrinol 2000 Aug;166(2):427-35 | |
| NP05510 |
VPINDLLDRASQRSDMLHSLSTTLTKDLSNHVPPVGWTMMPRPPLCHTSSLQTPNDKEQALQLSESDLMSLARSLLQAWQDPLVDLSNSANSLLHPSQSSISNKIRELQEHSKSLGDGLDILSGKMGPAAQAISSLPYRGSNDIGEDNISKLTNFHFLLSCFRRDSHKIDSFLKVLRCRAAKVQPEMC
|
188 | Sparus aurata | Somatotropin/prolactin | Prolactin |